![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
![]() | Superfamily b.34.2: SH3-domain [50044] (2 families) ![]() |
![]() | Family b.34.2.0: automated matches [191375] (1 protein) not a true family |
![]() | Protein automated matches [190457] (10 species) not a true protein |
![]() | Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [255229] (1 PDB entry) |
![]() | Domain d2i0na1: 2i0n A:10-80 [242081] Other proteins in same PDB: d2i0na2 automated match to d3ulrb_ |
PDB Entry: 2i0n (more details)
SCOPe Domain Sequences for d2i0na1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2i0na1 b.34.2.0 (A:10-80) automated matches {Slime mold (Dictyostelium discoideum) [TaxId: 44689]} akyaralkdynvsdtsllpfkrndiititfkdqenkwfmgqlngkegsfpvdhveillsd vpppqpvhpva
Timeline for d2i0na1: