Lineage for d2i0na1 (2i0n A:10-80)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2782861Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2783360Family b.34.2.0: automated matches [191375] (1 protein)
    not a true family
  6. 2783361Protein automated matches [190457] (10 species)
    not a true protein
  7. 2783667Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [255229] (1 PDB entry)
  8. 2783668Domain d2i0na1: 2i0n A:10-80 [242081]
    Other proteins in same PDB: d2i0na2
    automated match to d3ulrb_

Details for d2i0na1

PDB Entry: 2i0n (more details)

PDB Description: structure of dictyostelium discoideum myosin vii sh3 domain with adjacent proline rich region
PDB Compounds: (A:) Class VII unconventional myosin

SCOPe Domain Sequences for d2i0na1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2i0na1 b.34.2.0 (A:10-80) automated matches {Slime mold (Dictyostelium discoideum) [TaxId: 44689]}
akyaralkdynvsdtsllpfkrndiititfkdqenkwfmgqlngkegsfpvdhveillsd
vpppqpvhpva

SCOPe Domain Coordinates for d2i0na1:

Click to download the PDB-style file with coordinates for d2i0na1.
(The format of our PDB-style files is described here.)

Timeline for d2i0na1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2i0na2