Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
Family c.1.11.0: automated matches [227196] (1 protein) not a true family |
Protein automated matches [226923] (71 species) not a true protein |
Species Rhodobacter sphaeroides [TaxId:1063] [255226] (1 PDB entry) |
Domain d2hzgb2: 2hzg B:129-392 [242080] Other proteins in same PDB: d2hzga1, d2hzgb1 automated match to d3sjna2 complexed with gol, na |
PDB Entry: 2hzg (more details), 2.02 Å
SCOPe Domain Sequences for d2hzgb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hzgb2 c.1.11.0 (B:129-392) automated matches {Rhodobacter sphaeroides [TaxId: 1063]} sashgkrpyasllfgdtpqetleraraarrdgfaavkfgwgpigrgtvaadadqimaare glgpdgdlmvdvgqifgedveaaaarlptldaagvlwleepfdagalaahaalagrgarv riaggeaahnfhmaqhlmdygrigfiqidcgrigglgpakrvadaaqargityvnhtfts hlalsaslqpfagleadriceypaapqqlalditgdhirpdaeglirapeapglglqvaa salrrylveteiriggqliyrtpq
Timeline for d2hzgb2: