SCOP 1.59: Domain d1hlca_: 1hlc A:

Lineage for d1hlca_ (1hlc A:)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (12 families)

5. Family b.29.1.3: Galectin (animal S-lectin) [49932] (4 proteins)

6. Protein S-lectin, different isoforms [49933] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49935] (6 PDB entries)

8. Domain d1hlca_: 1hlc A: [24208]

Details for d1hlca_

PDB Entry: 1hlc, 2.9 Å

PDB Description: x-ray crystal structure of the human dimeric s-lac lectin, l-14-ii, in complex with lactose at 2.9 angstroms resolution

SCOP Domain Sequences for d1hlca_:

Sequence; same for both SEQRES and ATOM records:

>d1hlca_ b.29.1.3 (A:) S-lectin, different isoforms {Human (Homo sapiens)}
elevknmdmkpgstlkitgsiadgtdgfvinlgqgtdklnlhfnprfsestivcnsldgs
nwgqeqredhlcfspgsevkftvtfesdkfkvklpdgheltfpnrlghshlsylsvrggf
nmssfklke

Timeline for d1hlca_:

• d1hlca_ first appeared (with stable ids) in SCOP 1.55
  
• d1hlca_ appears in SCOP 1.57
  
• d1hlca_ appears in SCOP 1.61
  
• d1hlca_ appears in the current release, SCOPe 2.08