SCOPe 2.07: Domain d2ht9a_: 2ht9 A:

Lineage for d2ht9a_ (2ht9 A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (188 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188013] (113 PDB entries)

8. Domain d2ht9a_: 2ht9 A: [242075]
   automated match to d2flsa_
   complexed with fes, gsh

Details for d2ht9a_

PDB Entry: 2ht9, 1.9 Å

PDB Description: The structure of dimeric human glutaredoxin 2

PDB Compounds: (A:) Glutaredoxin-2

SCOPe Domain Sequences for d2ht9a_:

Sequence; same for both SEQRES and ATOM records:

>d2ht9a_ c.47.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
latapvnqiqetisdncvvifsktscsyctmakklfhdmnvnykvveldlleygnqfqda
lykmtgertvprifvngtfiggatdthrlhkegkllplvhqcyl

Timeline for d2ht9a_:

• d2ht9a_ first appeared in SCOPe 2.04
  
• d2ht9a_ appears in SCOPe 2.06
  
• d2ht9a_ appears in the current release, SCOPe 2.08