Lineage for d2hrha3 (2hrh A:300-496)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2770398Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2770399Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2772201Family b.6.1.0: automated matches [191502] (1 protein)
    not a true family
  6. 2772202Protein automated matches [190824] (31 species)
    not a true protein
  7. 2772417Species Funalia trogii [TaxId:76130] [255223] (2 PDB entries)
  8. 2772423Domain d2hrha3: 2hrh A:300-496 [242072]
    automated match to d1kyaa3
    complexed with cu

Details for d2hrha3

PDB Entry: 2hrh (more details), 2.6 Å

PDB Description: crystal structure of blue laccase from trametes trogii
PDB Compounds: (A:) laccase

SCOPe Domain Sequences for d2hrha3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hrha3 b.6.1.0 (A:300-496) automated matches {Funalia trogii [TaxId: 76130]}
vesalttlegtaapgspapggvdlalnmafgfaggkftingasftpptvpvllqilsgaq
saqdllpsgsvyslpanadieislpataaapgfphpfhlhghtfavvrsagsstynyenp
vyrdvvstgspgdnvtirfrtdnpgpwflhchidfhleagfavvmaedipevaatnpvpq
awsdlcptydalspddq

SCOPe Domain Coordinates for d2hrha3:

Click to download the PDB-style file with coordinates for d2hrha3.
(The format of our PDB-style files is described here.)

Timeline for d2hrha3: