Lineage for d2hrha2 (2hrh A:131-299)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2366402Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2366403Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2367979Family b.6.1.0: automated matches [191502] (1 protein)
    not a true family
  6. 2367980Protein automated matches [190824] (23 species)
    not a true protein
  7. 2368157Species Funalia trogii [TaxId:76130] [255223] (2 PDB entries)
  8. 2368162Domain d2hrha2: 2hrh A:131-299 [242071]
    automated match to d1kyaa2
    complexed with cbs, cu

Details for d2hrha2

PDB Entry: 2hrh (more details), 2.6 Å

PDB Description: crystal structure of blue laccase from trametes trogii
PDB Compounds: (A:) laccase

SCOPe Domain Sequences for d2hrha2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hrha2 b.6.1.0 (A:131-299) automated matches {Funalia trogii [TaxId: 76130]}
dphkslydvdddstvitladwyhlaakvgspvptadatlinglgrsidtlnadlavitvt
kgkryrfrlvslscdpnhvfsidghsltvieadsvnlkpqtvdsiqifaaqrysfvlnad
qdvgnywiralpnsgtrnfdggvnsailrydgaapvepttsqtpstnpl

SCOPe Domain Coordinates for d2hrha2:

Click to download the PDB-style file with coordinates for d2hrha2.
(The format of our PDB-style files is described here.)

Timeline for d2hrha2: