Lineage for d5galb_ (5gal B:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 459805Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 459806Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (21 families) (S)
  5. 460265Family b.29.1.3: Galectin (animal S-lectin) [49932] (8 proteins)
  6. 460328Protein Galectin-7 [100926] (1 species)
  7. 460329Species Human (Homo sapiens) [TaxId:9606] [49935] (5 PDB entries)
  8. 460337Domain d5galb_: 5gal B: [24207]

Details for d5galb_

PDB Entry: 5gal (more details), 2 Å

PDB Description: crystal structure of human galectin-7 in complex with n- acetyllactosamine

SCOP Domain Sequences for d5galb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5galb_ b.29.1.3 (B:) Galectin-7 {Human (Homo sapiens)}
phksslpegirpgtvlrirglvppnasrfhvnllcgeeqgsdaalhfnprldtsevvfns
keqgswgreergpgvpfqrgqpfevliiasddgfkavvgdaqyhhfrhrlplarvrlvev
ggdvqldsvrif

SCOP Domain Coordinates for d5galb_:

Click to download the PDB-style file with coordinates for d5galb_.
(The format of our PDB-style files is described here.)

Timeline for d5galb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d5gala_