Lineage for d2hrga1 (2hrg A:1-130)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2770398Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2770399Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2772201Family b.6.1.0: automated matches [191502] (1 protein)
    not a true family
  6. 2772202Protein automated matches [190824] (31 species)
    not a true protein
  7. 2772417Species Funalia trogii [TaxId:76130] [255223] (2 PDB entries)
  8. 2772418Domain d2hrga1: 2hrg A:1-130 [242067]
    automated match to d1kyaa1
    complexed with 4ma, ca, cu, gol

Details for d2hrga1

PDB Entry: 2hrg (more details), 1.58 Å

PDB Description: crystal structure of blue laccase from trametes trogii complexed with p-methylbenzoate
PDB Compounds: (A:) laccase

SCOPe Domain Sequences for d2hrga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hrga1 b.6.1.0 (A:1-130) automated matches {Funalia trogii [TaxId: 76130]}
aigpvadltisngavspdgfsrqailvndvfpsplitgnkgdrfqlnvidnmtnhtmlks
tsihwhgffqhgtnwadgpafvnqcpistghaflydfqvpdqagtfwyhshlstqycdgl
rgpivvydpq

SCOPe Domain Coordinates for d2hrga1:

Click to download the PDB-style file with coordinates for d2hrga1.
(The format of our PDB-style files is described here.)

Timeline for d2hrga1: