Lineage for d2hrfa1 (2hrf A:132-301)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2131616Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2131617Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2133854Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2133855Protein automated matches [190056] (165 species)
    not a true protein
  7. 2134369Species Human (Homo sapiens) [TaxId:9606] [188013] (106 PDB entries)
  8. 2134644Domain d2hrfa1: 2hrf A:132-301 [242066]
    Other proteins in same PDB: d2hrfa2
    automated match to d2b7ja1
    complexed with cu1

Details for d2hrfa1

PDB Entry: 2hrf (more details)

PDB Description: solution structure of cu(i) p174l hsco1
PDB Compounds: (A:) SCO1 protein homolog, mitochondrial

SCOPe Domain Sequences for d2hrfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hrfa1 c.47.1.0 (A:132-301) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gkpllggpfsltthtgerktdkdylgqwlliyfgfthcpdvcleelekmiqvvdeidsit
tlpdltplfisidperdtkeaianyvkefspklvgltgtreevdqvarayrvyyspgpkd
ededyivdhtiimyligpdgefldyfgqnkrkgeiaasiathmrpyrkks

SCOPe Domain Coordinates for d2hrfa1:

Click to download the PDB-style file with coordinates for d2hrfa1.
(The format of our PDB-style files is described here.)

Timeline for d2hrfa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2hrfa2