Lineage for d5gala_ (5gal A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1779936Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 1779937Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 1780718Family b.29.1.3: Galectin (animal S-lectin) [49932] (9 proteins)
  6. 1780872Protein Galectin-7 [100926] (1 species)
  7. 1780873Species Human (Homo sapiens) [TaxId:9606] [49935] (6 PDB entries)
  8. 1780884Domain d5gala_: 5gal A: [24206]

Details for d5gala_

PDB Entry: 5gal (more details), 2 Å

PDB Description: crystal structure of human galectin-7 in complex with n- acetyllactosamine
PDB Compounds: (A:) galectin-7

SCOPe Domain Sequences for d5gala_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5gala_ b.29.1.3 (A:) Galectin-7 {Human (Homo sapiens) [TaxId: 9606]}
snvphksslpegirpgtvlrirglvppnasrfhvnllcgeeqgsdaalhfnprldtsevv
fnskeqgswgreergpgvpfqrgqpfevliiasddgfkavvgdaqyhhfrhrlplarvrl
vevggdvqldsvrif

SCOPe Domain Coordinates for d5gala_:

Click to download the PDB-style file with coordinates for d5gala_.
(The format of our PDB-style files is described here.)

Timeline for d5gala_:

View in 3D
Domains from other chains:
(mouse over for more information)
d5galb_