SCOPe 2.04: Domain d2hqoa_: 2hqo A:

Lineage for d2hqoa_ (2hqo A:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (8 families)

5. Family c.23.1.0: automated matches [191324] (1 protein)
   not a true family

6. Protein automated matches [190131] (54 species)
   not a true protein

7. Species Helicobacter pylori [TaxId:85963] [255222] (2 PDB entries)

8. Domain d2hqoa_: 2hqo A: [242054]
   automated match to d2plna_

Details for d2hqoa_

PDB Entry: 2hqo

PDB Description: Structure of a Atypical Orphan Response Regulator Protein Revealed a New Phosphorylation-Independent Regulatory Mechanism

PDB Compounds: (A:) Putative transcriptional regulator

SCOPe Domain Sequences for d2hqoa_:

Sequence; same for both SEQRES and ATOM records:

>d2hqoa_ c.23.1.0 (A:) automated matches {Helicobacter pylori [TaxId: 85963]}
mrvllieknsvlggeiekglnvkgfmadvtesledgeylmdirnydlvmvsdknalsfvs
rikekhssivvlvssdnptseeevhafeqgaddyiakpyrsikalvariearlrfwgsn

Timeline for d2hqoa_:

• d2hqoa_ is new in SCOPe 2.04-stable
  
• d2hqoa_ appears in SCOPe 2.05
  
• d2hqoa_ appears in the current release, SCOPe 2.08