| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) ![]() consists of one domain of this fold |
| Family c.55.3.0: automated matches [191357] (1 protein) not a true family |
| Protein automated matches [190396] (40 species) not a true protein |
| Species Human immunodeficiency virus 1 [TaxId:11676] [225129] (16 PDB entries) |
| Domain d2hnza2: 2hnz A:430-537 [242051] Other proteins in same PDB: d2hnza1, d2hnzb_ automated match to d3dlga2 complexed with pc0, po4; mutant |
PDB Entry: 2hnz (more details), 3 Å
SCOPe Domain Sequences for d2hnza2:
Sequence, based on SEQRES records: (download)
>d2hnza2 c.55.3.0 (A:430-537) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]}
ekepivgaetfyvdgaanretklgkagyvtnrgrqkvvtltdttnqktelqaiylalqds
glevnivtdsqyalgiiqaqpdqseselvnqiieqlikkekvylawvp
>d2hnza2 c.55.3.0 (A:430-537) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]}
ekepivgaetfyvdagyvtnrgrqkvvtltdttnqktelqaiylalqdsglevnivtdsq
yalgiiqaqpdqseselvnqiieqlikkekvylawvp
Timeline for d2hnza2: