SCOPe 2.08: Domain d4galb_: 4gal B:

Lineage for d4galb_ (4gal B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families)

5. Family b.29.1.3: Galectin (animal S-lectin) [49932] (9 proteins)

6. Protein Galectin-7 [100926] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49935] (6 PDB entries)

8. Domain d4galb_: 4gal B: [24205]

Details for d4galb_

PDB Entry: 4gal, 1.95 Å

PDB Description: crystal structure of human galectin-7 in complex with lactose

PDB Compounds: (B:) galectin-7

SCOPe Domain Sequences for d4galb_:

Sequence; same for both SEQRES and ATOM records:

>d4galb_ b.29.1.3 (B:) Galectin-7 {Human (Homo sapiens) [TaxId: 9606]}
snvphksslpegirpgtvlrirglvppnasrfhvnllcgeeqgsdaalhfnprldtsevv
fnskeqgswgreergpgvpfqrgqpfevliiasddgfkavvgdaqyhhfrhrlplarvrl
vevggdvqldsvrif

Timeline for d4galb_:

• d4galb_ first appeared (with stable ids) in SCOP 1.55
  
• d4galb_ appears in SCOPe 2.07