| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.5: Flavoproteins [52218] (9 families) ![]() |
| Family c.23.5.0: automated matches [191330] (1 protein) not a true family |
| Protein automated matches [190158] (24 species) not a true protein |
| Species Escherichia coli [TaxId:562] [255218] (2 PDB entries) |
| Domain d2hnba_: 2hnb A: [242045] automated match to d1ykga1 |
PDB Entry: 2hnb (more details)
SCOPe Domain Sequences for d2hnba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hnba_ c.23.5.0 (A:) automated matches {Escherichia coli [TaxId: 562]}
maditlisgstlggaeyvaehlaekleeagfttetlhgplledlpasgiwlvissthgag
dipdnlspfyealqeqkpdlsavrfgaigigsreydtfcgaidkleaelknsgakqtget
lkinildhdipedpaeewlgswvnllk
Timeline for d2hnba_: