Lineage for d2hnba_ (2hnb A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1586636Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1587349Superfamily c.23.5: Flavoproteins [52218] (9 families) (S)
  5. 1587788Family c.23.5.0: automated matches [191330] (1 protein)
    not a true family
  6. 1587789Protein automated matches [190158] (17 species)
    not a true protein
  7. 1587833Species Escherichia coli [TaxId:562] [255218] (2 PDB entries)
  8. 1587834Domain d2hnba_: 2hnb A: [242045]
    automated match to d1ykga1

Details for d2hnba_

PDB Entry: 2hnb (more details)

PDB Description: solution structure of a bacterial holo-flavodoxin
PDB Compounds: (A:) Protein mioC

SCOPe Domain Sequences for d2hnba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hnba_ c.23.5.0 (A:) automated matches {Escherichia coli [TaxId: 562]}
maditlisgstlggaeyvaehlaekleeagfttetlhgplledlpasgiwlvissthgag
dipdnlspfyealqeqkpdlsavrfgaigigsreydtfcgaidkleaelknsgakqtget
lkinildhdipedpaeewlgswvnllk

SCOPe Domain Coordinates for d2hnba_:

Click to download the PDB-style file with coordinates for d2hnba_.
(The format of our PDB-style files is described here.)

Timeline for d2hnba_: