Lineage for d2hm8a1 (2hm8 A:319-449)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2725421Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2725422Superfamily a.118.1: ARM repeat [48371] (28 families) (S)
  5. 2725861Family a.118.1.14: MIF4G domain-like [100908] (6 proteins)
    duplication: family members contains 2 or more structurally similar domains of this fold connected by unstructured linkers
    this is a repeat family; one repeat unit is 1hu3 A:905-942 found in domain
  6. 2725898Protein Programmed cell death 4, PDCD4 [140815] (1 species)
  7. 2725899Species Mouse (Mus musculus) [TaxId:10090] [140816] (5 PDB entries)
    Uniprot Q61823 322-448! Uniprot Q61823 322-450
  8. 2725905Domain d2hm8a1: 2hm8 A:319-449 [242043]
    Other proteins in same PDB: d2hm8a2
    automated match to d2nsza1
    applies to all domains of a family if the common domain is composed of a different number of small repeating units

Details for d2hm8a1

PDB Entry: 2hm8 (more details)

PDB Description: solution structure of the c-terminal ma-3 domain of pdcd4
PDB Compounds: (A:) Pdcd4 C-terminal MA-3 domain

SCOPe Domain Sequences for d2hm8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hm8a1 a.118.1.14 (A:319-449) Programmed cell death 4, PDCD4 {Mouse (Mus musculus) [TaxId: 10090]}
ggqqpvnhlvkeidmllkeyllsgdiseaehclkelevphfhhelvyeaivmvlestges
afkmildllkslwksstitidqmkrgyeriyneipdinldvphsysvlerfveecfqagi
iskqlrdlcps

SCOPe Domain Coordinates for d2hm8a1:

Click to download the PDB-style file with coordinates for d2hm8a1.
(The format of our PDB-style files is described here.)

Timeline for d2hm8a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2hm8a2