SCOPe 2.08: Domain d2hm8a1: 2hm8 A:319-449

Lineage for d2hm8a1 (2hm8 A:319-449)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.1: ARM repeat [48371] (28 families)

5. Family a.118.1.14: MIF4G domain-like [100908] (6 proteins)
   duplication: family members contains 2 or more structurally similar domains of this fold connected by unstructured linkers
   this is a repeat family; one repeat unit is 1hu3 A:905-942 found in domain

6. Protein Programmed cell death 4, PDCD4 [140815] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [140816] (5 PDB entries)
   Uniprot Q61823 322-448! Uniprot Q61823 322-450

8. Domain d2hm8a1: 2hm8 A:319-449 [242043]
   Other proteins in same PDB: d2hm8a2
   automated match to d2nsza1
   applies to all domains of a family if the common domain is composed of a different number of small repeating units

Details for d2hm8a1

PDB Entry: 2hm8

PDB Description: solution structure of the c-terminal ma-3 domain of pdcd4

PDB Compounds: (A:) Pdcd4 C-terminal MA-3 domain

SCOPe Domain Sequences for d2hm8a1:

Sequence; same for both SEQRES and ATOM records:

>d2hm8a1 a.118.1.14 (A:319-449) Programmed cell death 4, PDCD4 {Mouse (Mus musculus) [TaxId: 10090]}
ggqqpvnhlvkeidmllkeyllsgdiseaehclkelevphfhhelvyeaivmvlestges
afkmildllkslwksstitidqmkrgyeriyneipdinldvphsysvlerfveecfqagi
iskqlrdlcps

Timeline for d2hm8a1:

• d2hm8a1 first appeared in SCOPe 2.04, called d2hm8a_
  
• d2hm8a1 appears in SCOPe 2.07