Lineage for d2hm2q_ (2hm2 Q:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2332045Fold a.77: DEATH domain [47985] (1 superfamily)
    6 helices: closed bundle; greek-key; internal pseudo twofold symmetry
  4. 2332046Superfamily a.77.1: DEATH domain [47986] (5 families) (S)
  5. 2332159Family a.77.1.5: Pyrin domain, PYD [101298] (3 proteins)
    automatically mapped to Pfam PF02758
  6. 2332166Protein automated matches [254538] (1 species)
    not a true protein
  7. 2332167Species Human (Homo sapiens) [TaxId:9606] [255215] (1 PDB entry)
  8. 2332168Domain d2hm2q_: 2hm2 Q: [242042]
    automated match to d1ucpa_

Details for d2hm2q_

PDB Entry: 2hm2 (more details)

PDB Description: solution structure of asc2
PDB Compounds: (Q:) Pyrin-only protein 1

SCOPe Domain Sequences for d2hm2q_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hm2q_ a.77.1.5 (Q:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mgtkreailkvlenltpeelkkfkmklgtvplregferiprgalgqldivdltdklvasy
yedyaaelvvavlrdmrmleeaarlqraa

SCOPe Domain Coordinates for d2hm2q_:

Click to download the PDB-style file with coordinates for d2hm2q_.
(The format of our PDB-style files is described here.)

Timeline for d2hm2q_: