Class a: All alpha proteins [46456] (290 folds) |
Fold a.77: DEATH domain [47985] (1 superfamily) 6 helices: closed bundle; greek-key; internal pseudo twofold symmetry |
Superfamily a.77.1: DEATH domain [47986] (5 families) |
Family a.77.1.5: Pyrin domain, PYD [101298] (3 proteins) automatically mapped to Pfam PF02758 |
Protein automated matches [254538] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [255215] (1 PDB entry) |
Domain d2hm2q_: 2hm2 Q: [242042] automated match to d1ucpa_ |
PDB Entry: 2hm2 (more details)
SCOPe Domain Sequences for d2hm2q_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hm2q_ a.77.1.5 (Q:) automated matches {Human (Homo sapiens) [TaxId: 9606]} mgtkreailkvlenltpeelkkfkmklgtvplregferiprgalgqldivdltdklvasy yedyaaelvvavlrdmrmleeaarlqraa
Timeline for d2hm2q_: