SCOP 1.73: Domain d4gala_: 4gal A:

Lineage for d4gala_ (4gal A:)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (25 families)

5. Family b.29.1.3: Galectin (animal S-lectin) [49932] (8 proteins)

6. Protein Galectin-7 [100926] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49935] (5 PDB entries)

8. Domain d4gala_: 4gal A: [24204]

Details for d4gala_

PDB Entry: 4gal, 1.95 Å

PDB Description: crystal structure of human galectin-7 in complex with lactose

PDB Compounds: (A:) galectin-7

SCOP Domain Sequences for d4gala_:

Sequence; same for both SEQRES and ATOM records:

>d4gala_ b.29.1.3 (A:) Galectin-7 {Human (Homo sapiens) [TaxId: 9606]}
snvphksslpegirpgtvlrirglvppnasrfhvnllcgeeqgsdaalhfnprldtsevv
fnskeqgswgreergpgvpfqrgqpfevliiasddgfkavvgdaqyhhfrhrlplarvrl
vevggdvqldsvrif

Timeline for d4gala_:

• d4gala_ first appeared (with stable ids) in SCOP 1.55
  
• d4gala_ appears in SCOP 1.71
  
• d4gala_ appears in SCOP 1.75
  
• d4gala_ appears in the current release, SCOPe 2.08