Lineage for d4gala_ (4gal A:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 57551Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
  4. 57552Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (11 families) (S)
  5. 57872Family b.29.1.3: Galectin (animal S-lectin) [49932] (4 proteins)
  6. 57884Protein S-lectin, different isoforms [49933] (4 species)
  7. 57901Species Human (Homo sapiens) [TaxId:9606] [49935] (6 PDB entries)
  8. 57908Domain d4gala_: 4gal A: [24204]

Details for d4gala_

PDB Entry: 4gal (more details), 1.95 Å

PDB Description: crystal structure of human galectin-7 in complex with lactose

SCOP Domain Sequences for d4gala_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gala_ b.29.1.3 (A:) S-lectin, different isoforms {Human (Homo sapiens)}
snvphksslpegirpgtvlrirglvppnasrfhvnllcgeeqgsdaalhfnprldtsevv
fnskeqgswgreergpgvpfqrgqpfevliiasddgfkavvgdaqyhhfrhrlplarvrl
vevggdvqldsvrif

SCOP Domain Coordinates for d4gala_:

Click to download the PDB-style file with coordinates for d4gala_.
(The format of our PDB-style files is described here.)

Timeline for d4gala_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4galb_