Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.5: RNase A-like [54075] (1 superfamily) contains long curved beta-sheet and 3 helices |
Superfamily d.5.1: RNase A-like [54076] (2 families) can be classified as disulfide-rich |
Family d.5.1.0: automated matches [191478] (1 protein) not a true family |
Protein automated matches [190767] (6 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [255211] (2 PDB entries) |
Domain d2hkya1: 2hky A:1-128 [242039] Other proteins in same PDB: d2hkya2 automated match to d1gqva_ |
PDB Entry: 2hky (more details)
SCOPe Domain Sequences for d2hkya1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hkya1 d.5.1.0 (A:1-128) automated matches {Human (Homo sapiens) [TaxId: 9606]} kpkgmtssqwfkiqhmqpspqacnsamkninkhtkrckdlntflhepfssvaatcqtpki ackngdknchqshgpvsltmckltsgkypncrykekrqnksyvvackppqkkdsqqfhlv pvhldrvl
Timeline for d2hkya1: