Lineage for d2hkya_ (2hky A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1635083Fold d.5: RNase A-like [54075] (1 superfamily)
    contains long curved beta-sheet and 3 helices
  4. 1635084Superfamily d.5.1: RNase A-like [54076] (2 families) (S)
    can be classified as disulfide-rich
  5. 1635602Family d.5.1.0: automated matches [191478] (1 protein)
    not a true family
  6. 1635603Protein automated matches [190767] (5 species)
    not a true protein
  7. 1635612Species Human (Homo sapiens) [TaxId:9606] [255211] (1 PDB entry)
  8. 1635613Domain d2hkya_: 2hky A: [242039]
    automated match to d1gqva_

Details for d2hkya_

PDB Entry: 2hky (more details)

PDB Description: nmr solution structure of human rnase 7
PDB Compounds: (A:) Ribonuclease 7

SCOPe Domain Sequences for d2hkya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hkya_ d.5.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mkpkgmtssqwfkiqhmqpspqacnsamkninkhtkrckdlntflhepfssvaatcqtpk
iackngdknchqshgpvsltmckltsgkypncrykekrqnksyvvackppqkkdsqqfhl
vpvhldrvl

SCOPe Domain Coordinates for d2hkya_:

Click to download the PDB-style file with coordinates for d2hkya_.
(The format of our PDB-style files is described here.)

Timeline for d2hkya_: