SCOPe 2.07: Domain d2hh2a_: 2hh2 A:

Lineage for d2hh2a_ (2hh2 A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.51: Eukaryotic type KH-domain (KH-domain type I) [54790] (1 superfamily)
   beta-alpha(2)-beta(2)-alpha; 2 layers: alpha/beta

4. Superfamily d.51.1: Eukaryotic type KH-domain (KH-domain type I) [54791] (2 families)
   Prokaryotic and eukaryotic domains share a KH-motif but have different topologies

5. Family d.51.1.0: automated matches [227159] (1 protein)
   not a true family

6. Protein automated matches [226866] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225002] (11 PDB entries)

8. Domain d2hh2a_: 2hh2 A: [242036]
   automated match to d1zzia_

Details for d2hh2a_

PDB Entry: 2hh2

PDB Description: solution structure of the fourth kh domain of ksrp

PDB Compounds: (A:) KH-type splicing regulatory protein

SCOPe Domain Sequences for d2hh2a_:

Sequence; same for both SEQRES and ATOM records:

>d2hh2a_ d.51.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gemtfsipthkcglvigrggenvkainqqtgafveisrqlppngdpnfklfiirgspqqi
dhakqlieekiegplcpvg

Timeline for d2hh2a_:

• d2hh2a_ first appeared in SCOPe 2.04
  
• d2hh2a_ appears in SCOPe 2.06
  
• d2hh2a_ appears in the current release, SCOPe 2.08