Lineage for d2hh2a_ (2hh2 A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2190768Fold d.51: Eukaryotic type KH-domain (KH-domain type I) [54790] (1 superfamily)
    beta-alpha(2)-beta(2)-alpha; 2 layers: alpha/beta
  4. 2190769Superfamily d.51.1: Eukaryotic type KH-domain (KH-domain type I) [54791] (2 families) (S)
    Prokaryotic and eukaryotic domains share a KH-motif but have different topologies
  5. 2190877Family d.51.1.0: automated matches [227159] (1 protein)
    not a true family
  6. 2190878Protein automated matches [226866] (4 species)
    not a true protein
  7. 2190879Species Human (Homo sapiens) [TaxId:9606] [225002] (8 PDB entries)
  8. 2190891Domain d2hh2a_: 2hh2 A: [242036]
    automated match to d1zzia_

Details for d2hh2a_

PDB Entry: 2hh2 (more details)

PDB Description: solution structure of the fourth kh domain of ksrp
PDB Compounds: (A:) KH-type splicing regulatory protein

SCOPe Domain Sequences for d2hh2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hh2a_ d.51.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gemtfsipthkcglvigrggenvkainqqtgafveisrqlppngdpnfklfiirgspqqi
dhakqlieekiegplcpvg

SCOPe Domain Coordinates for d2hh2a_:

Click to download the PDB-style file with coordinates for d2hh2a_.
(The format of our PDB-style files is described here.)

Timeline for d2hh2a_: