Lineage for d2hgma_ (2hgm A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2951860Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families) (S)
  5. 2952471Family d.58.7.0: automated matches [191529] (1 protein)
    not a true family
  6. 2952472Protein automated matches [190896] (11 species)
    not a true protein
  7. 2952511Species Human (Homo sapiens) [TaxId:9606] [188315] (106 PDB entries)
  8. 2952680Domain d2hgma_: 2hgm A: [242035]
    automated match to d2ek1g_

Details for d2hgma_

PDB Entry: 2hgm (more details)

PDB Description: nmr structure of the second qrrm domain of human hnrnp f
PDB Compounds: (A:) heterogeneous nuclear ribonucleoprotein F

SCOPe Domain Sequences for d2hgma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hgma_ d.58.7.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nsadsandgfvrlrglpfgctkeeivqffsgleivpngitlpvdpegkitgeafvqfasq
elaekalgkhkerighryievfkssqeevrsy

SCOPe Domain Coordinates for d2hgma_:

Click to download the PDB-style file with coordinates for d2hgma_.
(The format of our PDB-style files is described here.)

Timeline for d2hgma_: