SCOPe 2.06: Domain d2hg0a2: 2hg0 A:301-400

Lineage for d2hg0a2 (2hg0 A:301-400)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.0: automated matches [191341] (1 protein)
   not a true family

6. Protein automated matches [190226] (55 species)
   not a true protein

7. Species West Nile virus [TaxId:11082] [255209] (2 PDB entries)

8. Domain d2hg0a2: 2hg0 A:301-400 [242034]
   Other proteins in same PDB: d2hg0a1
   automated match to d1urza1

Details for d2hg0a2

PDB Entry: 2hg0, 3 Å

PDB Description: structure of the west nile virus envelope glycoprotein

PDB Compounds: (A:) Envelope glycoprotein

SCOPe Domain Sequences for d2hg0a2:

Sequence; same for both SEQRES and ATOM records:

>d2hg0a2 b.1.18.0 (A:301-400) automated matches {West Nile virus [TaxId: 11082]}
tygvcskafkflgtpadtghgtvvlelqytgtdgpckvpissvaslndltpvgrlvtvnp
fvsvatanakvlieleppfgdsyivvgrgeqqinhhwhks

Timeline for d2hg0a2:

• d2hg0a2 first appeared in SCOPe 2.04
  
• d2hg0a2 appears in SCOPe 2.05
  
• d2hg0a2 appears in SCOPe 2.07
  
• d2hg0a2 appears in the current release, SCOPe 2.08