Lineage for d2hg0a2 (2hg0 A:301-400)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1523789Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 1524658Family b.1.18.0: automated matches [191341] (1 protein)
    not a true family
  6. 1524659Protein automated matches [190226] (39 species)
    not a true protein
  7. 1524862Species West Nile virus [TaxId:11082] [255209] (2 PDB entries)
  8. 1524864Domain d2hg0a2: 2hg0 A:301-400 [242034]
    Other proteins in same PDB: d2hg0a1
    automated match to d1urza1

Details for d2hg0a2

PDB Entry: 2hg0 (more details), 3 Å

PDB Description: structure of the west nile virus envelope glycoprotein
PDB Compounds: (A:) Envelope glycoprotein

SCOPe Domain Sequences for d2hg0a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hg0a2 b.1.18.0 (A:301-400) automated matches {West Nile virus [TaxId: 11082]}
tygvcskafkflgtpadtghgtvvlelqytgtdgpckvpissvaslndltpvgrlvtvnp
fvsvatanakvlieleppfgdsyivvgrgeqqinhhwhks

SCOPe Domain Coordinates for d2hg0a2:

Click to download the PDB-style file with coordinates for d2hg0a2.
(The format of our PDB-style files is described here.)

Timeline for d2hg0a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2hg0a1