Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (27 families) "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
Family b.1.18.0: automated matches [191341] (1 protein) not a true family |
Protein automated matches [190226] (81 species) not a true protein |
Species West Nile virus [TaxId:11082] [255209] (2 PDB entries) |
Domain d2hg0a2: 2hg0 A:301-400 [242034] Other proteins in same PDB: d2hg0a1 automated match to d1urza1 |
PDB Entry: 2hg0 (more details), 3 Å
SCOPe Domain Sequences for d2hg0a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hg0a2 b.1.18.0 (A:301-400) automated matches {West Nile virus [TaxId: 11082]} tygvcskafkflgtpadtghgtvvlelqytgtdgpckvpissvaslndltpvgrlvtvnp fvsvatanakvlieleppfgdsyivvgrgeqqinhhwhks
Timeline for d2hg0a2: