SCOPe 2.05: Domain d2hg0a1: 2hg0 A:1-300

Lineage for d2hg0a1 (2hg0 A:1-300)

1. Root: SCOPe 2.05

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.10: Viral glycoprotein, central and dimerisation domains [56982] (1 superfamily)
   2 intertwined domains; all-beta and alpha+beta

4. Superfamily f.10.1: Viral glycoprotein, central and dimerisation domains [56983] (2 families)

5. Family f.10.1.0: automated matches [227258] (1 protein)
   not a true family

6. Protein automated matches [227047] (5 species)
   not a true protein

7. Species West Nile virus [TaxId:11082] [255208] (2 PDB entries)

8. Domain d2hg0a1: 2hg0 A:1-300 [242033]
   Other proteins in same PDB: d2hg0a2
   automated match to d1urza2

Details for d2hg0a1

PDB Entry: 2hg0, 3 Å

PDB Description: structure of the west nile virus envelope glycoprotein

PDB Compounds: (A:) Envelope glycoprotein

SCOPe Domain Sequences for d2hg0a1:

Sequence; same for both SEQRES and ATOM records:

>d2hg0a1 f.10.1.0 (A:1-300) automated matches {West Nile virus [TaxId: 11082]}
fnclgmsnrdflegvsgatwvdlvlegdscvtimskdkptidvkmmnmeaanlaevrsyc
ylatvsdlstkaacptmgeahndkradpafvcrqgvvdrgwgngcglfgkgsidtcakfa
cstkaigrtilkenikyevaifvhgpttveshgnystqvgatqagrfsitpaapsytlkl
geygevtvdceprsgidtnayyvmtvgtktflvhrewfmdlnlpwssagstvwrnretlm
efeephatkqsvialgsqegalhqalagaipvefssntvkltsghlkcrvkmeklqlkgt

Timeline for d2hg0a1:

• d2hg0a1 first appeared in SCOPe 2.04
  
• d2hg0a1 appears in SCOPe 2.06
  
• d2hg0a1 appears in the current release, SCOPe 2.08