Lineage for d1bkzb_ (1bkz B:)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 164500Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
  4. 164501Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (14 families) (S)
  5. 164840Family b.29.1.3: Galectin (animal S-lectin) [49932] (4 proteins)
  6. 164854Protein S-lectin, different isoforms [49933] (4 species)
  7. 164871Species Human (Homo sapiens) [TaxId:9606] [49935] (6 PDB entries)
  8. 164873Domain d1bkzb_: 1bkz B: [24203]

Details for d1bkzb_

PDB Entry: 1bkz (more details), 1.9 Å

PDB Description: crystal structure of human galectin-7

SCOP Domain Sequences for d1bkzb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bkzb_ b.29.1.3 (B:) S-lectin, different isoforms {Human (Homo sapiens)}
snvphksslpegirpgtvlrirglvppnasrfhvnllcgeeqgsdaalhfnprldtsevv
fnskeqgswgreergpgvpfqrgqpfevliiasddgfkavvgdaqyhhfrhrlplarvrl
vevggdvqldsvrif

SCOP Domain Coordinates for d1bkzb_:

Click to download the PDB-style file with coordinates for d1bkzb_.
(The format of our PDB-style files is described here.)

Timeline for d1bkzb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1bkza_