Lineage for d1bkzb_ (1bkz B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2779190Family b.29.1.3: Galectin (animal S-lectin) [49932] (9 proteins)
  6. 2779438Protein Galectin-7 [100926] (1 species)
  7. 2779439Species Human (Homo sapiens) [TaxId:9606] [49935] (6 PDB entries)
  8. 2779443Domain d1bkzb_: 1bkz B: [24203]

Details for d1bkzb_

PDB Entry: 1bkz (more details), 1.9 Å

PDB Description: crystal structure of human galectin-7
PDB Compounds: (B:) galectin-7

SCOPe Domain Sequences for d1bkzb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bkzb_ b.29.1.3 (B:) Galectin-7 {Human (Homo sapiens) [TaxId: 9606]}
snvphksslpegirpgtvlrirglvppnasrfhvnllcgeeqgsdaalhfnprldtsevv
fnskeqgswgreergpgvpfqrgqpfevliiasddgfkavvgdaqyhhfrhrlplarvrl
vevggdvqldsvrif

SCOPe Domain Coordinates for d1bkzb_:

Click to download the PDB-style file with coordinates for d1bkzb_.
(The format of our PDB-style files is described here.)

Timeline for d1bkzb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1bkza_