SCOPe 2.04: Domain d2he0a_: 2he0 A:

Lineage for d2he0a_ (2he0 A:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies)
   multiple repeats of beta(2)-alpha(2) motif

4. Superfamily d.211.1: Ankyrin repeat [48403] (2 families)
   repeats organized in elongated structures

5. Family d.211.1.1: Ankyrin repeat [48404] (18 proteins)
   this is a repeat family; one repeat unit is 1ixv A:101-134 found in domain

6. Protein automated matches [190101] (6 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187689] (7 PDB entries)

8. Domain d2he0a_: 2he0 A: [242026]
   automated match to d2f8yb_
   complexed with edo; mutant

Details for d2he0a_

PDB Entry: 2he0, 1.9 Å

PDB Description: crystal structure of a human notch1 ankyrin domain mutant

PDB Compounds: (A:) Notch1 preproprotein variant

SCOPe Domain Sequences for d2he0a_:

Sequence; same for both SEQRES and ATOM records:

>d2he0a_ d.211.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hnqtdrtgatalhlaaaysrsdaakrlleasadaniqdnmgrtplhaavsadaqgvfqil
irnratdldarmhdgttplilaarlavegmledlinshadvnavddlgksalhwaaavnn
vdaavvllkngankdmqnnreetplflaaregsyetakvlldhfanrditdhmdrlprdi
aqermhhdivrlldl

Timeline for d2he0a_:

• d2he0a_ is new in SCOPe 2.04-stable
  
• d2he0a_ appears in SCOPe 2.05
  
• d2he0a_ appears in the current release, SCOPe 2.08, called d2he0a1