SCOPe 2.05: Domain d2hdma_: 2hdm A:

Lineage for d2hdma_ (2hdm A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.9: IL8-like [54116] (2 superfamilies)
   beta(3)-alpha

4. Superfamily d.9.1: Interleukin 8-like chemokines [54117] (2 families)
   form dimers with different dimerisation modes

5. Family d.9.1.1: Interleukin 8-like chemokines [54118] (25 proteins)

6. Protein automated matches [190403] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187277] (18 PDB entries)

8. Domain d2hdma_: 2hdm A: [242025]
   automated match to d1j9oa_

Details for d2hdma_

PDB Entry: 2hdm

PDB Description: solution structure of v21c/v59c lymphotactin/xcl1

PDB Compounds: (A:) Lymphotactin

SCOPe Domain Sequences for d2hdma_:

Sequence; same for both SEQRES and ATOM records:

>d2hdma_ d.9.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gsevsdkrtcvslttqrlpcsriktytitegslravifitkrglkvcadpqatwvrdcvr
smdrksntrnnmiq

Timeline for d2hdma_:

• d2hdma_ first appeared in SCOPe 2.04
  
• d2hdma_ appears in SCOPe 2.06
  
• d2hdma_ appears in the current release, SCOPe 2.08