Lineage for d1bkza_ (1bkz A:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 12390Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
  4. 12391Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (11 families) (S)
  5. 12682Family b.29.1.3: Galectin (animal S-lectin) [49932] (4 proteins)
  6. 12694Protein S-lectin, different isoforms [49933] (4 species)
  7. 12711Species Human (Homo sapiens) [TaxId:9606] [49935] (6 PDB entries)
  8. 12712Domain d1bkza_: 1bkz A: [24202]

Details for d1bkza_

PDB Entry: 1bkz (more details), 1.9 Å

PDB Description: crystal structure of human galectin-7

SCOP Domain Sequences for d1bkza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bkza_ b.29.1.3 (A:) S-lectin, different isoforms {Human (Homo sapiens)}
snvphksslpegirpgtvlrirglvppnasrfhvnllcgeeqgsdaalhfnprldtsevv
fnskeqgswgreergpgvpfqrgqpfevliiasddgfkavvgdaqyhhfrhrlplarvrl
vevggdvqldsvrif

SCOP Domain Coordinates for d1bkza_:

Click to download the PDB-style file with coordinates for d1bkza_.
(The format of our PDB-style files is described here.)

Timeline for d1bkza_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1bkzb_