Lineage for d2h89d_ (2h89 D:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024525Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies)
    core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices
  4. 3024622Superfamily f.21.2: Fumarate reductase respiratory complex transmembrane subunits [81343] (2 families) (S)
    two distinct families: in one family the common fold is contained in a single-chain subunit, in the other it is formed by two chains
  5. 3024642Family f.21.2.2: Succinate dehydrogenase/Fumarate reductase transmembrane subunits (SdhC/FrdC and SdhD/FrdD) [81373] (7 proteins)
    consists of two homologous non-identical subunits that form a heterodimer; may or may not contain heme groups
  6. 3024728Protein automated matches [254461] (3 species)
    not a true protein
  7. 3024729Species Chicken (Gallus gallus) [TaxId:9031] [254987] (13 PDB entries)
  8. 3024751Domain d2h89d_: 2h89 D: [242016]
    Other proteins in same PDB: d2h89b1, d2h89b2
    automated match to d1zoyd_
    complexed with bhg, f3s, fad, fes, hem, k, mli, pee, sf4, unl

Details for d2h89d_

PDB Entry: 2h89 (more details), 2.4 Å

PDB Description: avian respiratory complex ii with malonate bound
PDB Compounds: (D:) Succinate dehydrogenase cytochrome B, small subunit

SCOPe Domain Sequences for d2h89d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h89d_ f.21.2.2 (D:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
sskaaslhwtseravsalllgllpaaylypgpavdyslaaaltlhghwglgqvitdyvhg
dtpikvantglyvlsaitftglcyfnyydvgickavamlwsi

SCOPe Domain Coordinates for d2h89d_:

Click to download the PDB-style file with coordinates for d2h89d_.
(The format of our PDB-style files is described here.)

Timeline for d2h89d_: