Lineage for d2h89b2 (2h89 B:115-247)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2689591Superfamily a.1.2: alpha-helical ferredoxin [46548] (3 families) (S)
    contains two Fe4-S4 clusters
  5. 2689592Family a.1.2.1: Fumarate reductase/Succinate dehydogenase iron-sulfur protein, C-terminal domain [46549] (3 proteins)
  6. 2689623Protein Succinate dehydogenase [81669] (3 species)
  7. 2689624Species Chicken (Gallus gallus) [TaxId:9031] [254764] (6 PDB entries)
  8. 2689633Domain d2h89b2: 2h89 B:115-247 [242015]
    Other proteins in same PDB: d2h89b1, d2h89d_
    automated match to d1yq3b2
    complexed with bhg, f3s, fad, fes, hem, k, mli, pee, sf4, unl

Details for d2h89b2

PDB Entry: 2h89 (more details), 2.4 Å

PDB Description: avian respiratory complex ii with malonate bound
PDB Compounds: (B:) succinate dehydrogenase Ip subunit

SCOPe Domain Sequences for d2h89b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h89b2 a.1.2.1 (B:115-247) Succinate dehydogenase {Chicken (Gallus gallus) [TaxId: 9031]}
lsnfyaqyksiepylkkkdeskqgkeqylqsiedrqkldglyecilcaccstscpsywwn
gdkylgpavlmqayrwmidsrddyteerlaqlqdpfslyrchtimnctrtcpkglnpgka
iaeikkmmatyke

SCOPe Domain Coordinates for d2h89b2:

Click to download the PDB-style file with coordinates for d2h89b2.
(The format of our PDB-style files is described here.)

Timeline for d2h89b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2h89b1
View in 3D
Domains from other chains:
(mouse over for more information)
d2h89d_