Lineage for d2h88o2 (2h88 O:115-246)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2299347Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2303053Superfamily a.1.2: alpha-helical ferredoxin [46548] (3 families) (S)
    contains two Fe4-S4 clusters
  5. 2303054Family a.1.2.1: Fumarate reductase/Succinate dehydogenase iron-sulfur protein, C-terminal domain [46549] (3 proteins)
  6. 2303085Protein Succinate dehydogenase [81669] (3 species)
  7. 2303086Species Chicken (Gallus gallus) [TaxId:9031] [254764] (6 PDB entries)
  8. 2303088Domain d2h88o2: 2h88 O:115-246 [242012]
    Other proteins in same PDB: d2h88b1, d2h88d_, d2h88o1, d2h88q_
    automated match to d1yq3b2
    complexed with azi, bhg, f3s, fad, fes, gol, hem, k, sf4, teo, unl

Details for d2h88o2

PDB Entry: 2h88 (more details), 1.74 Å

PDB Description: avian mitochondrial respiratory complex ii at 1.8 angstrom resolution
PDB Compounds: (O:) succinate dehydrogenase Ip subunit

SCOPe Domain Sequences for d2h88o2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h88o2 a.1.2.1 (O:115-246) Succinate dehydogenase {Chicken (Gallus gallus) [TaxId: 9031]}
lsnfyaqyksiepylkkkdeskqgkeqylqsiedrqkldglyecilcaccstscpsywwn
gdkylgpavlmqayrwmidsrddyteerlaqlqdpfslyrchtimnctrtcpkglnpgka
iaeikkmmatyk

SCOPe Domain Coordinates for d2h88o2:

Click to download the PDB-style file with coordinates for d2h88o2.
(The format of our PDB-style files is described here.)

Timeline for d2h88o2: