Lineage for d2h88o1 (2h88 O:8-114)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2538334Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2540890Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) (S)
  5. 2541095Family d.15.4.2: 2Fe-2S ferredoxin domains from multidomain proteins [54312] (14 proteins)
  6. 2541199Protein Succinate dehydogenase iron-sulfur protein, N-terminal domain [82586] (3 species)
  7. 2541200Species Chicken (Gallus gallus) [TaxId:9031] [254759] (6 PDB entries)
  8. 2541202Domain d2h88o1: 2h88 O:8-114 [242011]
    Other proteins in same PDB: d2h88b2, d2h88d_, d2h88o2, d2h88q_
    automated match to d1yq3b1
    complexed with azi, bhg, f3s, fad, fes, gol, hem, k, sf4, teo, unl

Details for d2h88o1

PDB Entry: 2h88 (more details), 1.74 Å

PDB Description: avian mitochondrial respiratory complex ii at 1.8 angstrom resolution
PDB Compounds: (O:) succinate dehydrogenase Ip subunit

SCOPe Domain Sequences for d2h88o1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h88o1 d.15.4.2 (O:8-114) Succinate dehydogenase iron-sulfur protein, N-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}
tsrikkfsiyrwdpdkpgdkprmqtyevdlnkcgpmvldalikikneldstltfrrscre
gicgscamniaggntlactkkidpdlskttkiyplphmyvvkdlvpd

SCOPe Domain Coordinates for d2h88o1:

Click to download the PDB-style file with coordinates for d2h88o1.
(The format of our PDB-style files is described here.)

Timeline for d2h88o1: