SCOP 1.75: Domain d3galb_: 3gal B:

Lineage for d3galb_ (3gal B:)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (25 families)

5. Family b.29.1.3: Galectin (animal S-lectin) [49932] (8 proteins)

6. Protein Galectin-7 [100926] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49935] (5 PDB entries)

8. Domain d3galb_: 3gal B: [24201]
   complexed with 1gn

Details for d3galb_

PDB Entry: 3gal, 1.9 Å

PDB Description: crystal structure of human galectin-7 in complex with galactosamine

PDB Compounds: (B:) galectin-7

SCOP Domain Sequences for d3galb_:

Sequence; same for both SEQRES and ATOM records:

>d3galb_ b.29.1.3 (B:) Galectin-7 {Human (Homo sapiens) [TaxId: 9606]}
snvphksslpegirpgtvlrirglvppnasrfhvnllcgeeqgsdaalhfnprldtsevv
fnskeqgswgreergpgvpfqrgqpfevliiasddgfkavvgdaqyhhfrhrlplarvrl
vevggdvqldsvrif

Timeline for d3galb_:

• d3galb_ first appeared (with stable ids) in SCOP 1.55
  
• d3galb_ appears in SCOP 1.73
  
• d3galb_ appears in SCOPe 2.01
  
• d3galb_ appears in the current release, SCOPe 2.08