Class a: All alpha proteins [46456] (285 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.2: alpha-helical ferredoxin [46548] (3 families) contains two Fe4-S4 clusters |
Family a.1.2.1: Fumarate reductase/Succinate dehydogenase iron-sulfur protein, C-terminal domain [46549] (3 proteins) |
Protein Succinate dehydogenase [81669] (3 species) |
Species Chicken (Gallus gallus) [TaxId:9031] [254764] (6 PDB entries) |
Domain d2h88b2: 2h88 B:115-246 [242009] Other proteins in same PDB: d2h88b1, d2h88d_, d2h88o1, d2h88q_ automated match to d1yq3b2 complexed with azi, bhg, f3s, fad, fes, gol, hem, k, sf4, teo, unl |
PDB Entry: 2h88 (more details), 1.74 Å
SCOPe Domain Sequences for d2h88b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2h88b2 a.1.2.1 (B:115-246) Succinate dehydogenase {Chicken (Gallus gallus) [TaxId: 9031]} lsnfyaqyksiepylkkkdeskqgkeqylqsiedrqkldglyecilcaccstscpsywwn gdkylgpavlmqayrwmidsrddyteerlaqlqdpfslyrchtimnctrtcpkglnpgka iaeikkmmatyk
Timeline for d2h88b2:
View in 3D Domains from other chains: (mouse over for more information) d2h88d_, d2h88o1, d2h88o2, d2h88q_ |