SCOPe 2.05: Domain d2h5ua2: 2h5u A:131-300

Lineage for d2h5ua2 (2h5u A:131-300)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.0: automated matches [191502] (1 protein)
   not a true family

6. Protein automated matches [190824] (21 species)
   not a true protein

7. Species Trametes maxima [TaxId:259368] [255201] (1 PDB entry)

8. Domain d2h5ua2: 2h5u A:131-300 [242004]
   automated match to d1kyaa2
   complexed with cu, nag

Details for d2h5ua2

PDB Entry: 2h5u, 1.9 Å

PDB Description: crystal structure of laccase from cerrena maxima at 1.9a resolution

PDB Compounds: (A:) laccase

SCOPe Domain Sequences for d2h5ua2:

Sequence; same for both SEQRES and ATOM records:

>d2h5ua2 b.6.1.0 (A:131-300) automated matches {Trametes maxima [TaxId: 259368]}
dphasrydvdnddttitladwyhtaaklgpafpngadstlingkgrapsdssaqlsvvsv
tkgkryrfrlvslscdpnftfsidghnntiietdsvnsqplntdsiqifaaqrysftlna
nqavdnywiranpnfgnvgfngginsailrydgapavepttnqststqpl

Timeline for d2h5ua2:

• d2h5ua2 first appeared in SCOPe 2.04
  
• d2h5ua2 appears in SCOPe 2.06
  
• d2h5ua2 appears in the current release, SCOPe 2.08