| Class b: All beta proteins [48724] (180 folds) |
| Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) ![]() contains copper-binding site |
| Family b.6.1.0: automated matches [191502] (1 protein) not a true family |
| Protein automated matches [190824] (31 species) not a true protein |
| Species Trametes maxima [TaxId:259368] [255201] (1 PDB entry) |
| Domain d2h5ua1: 2h5u A:1-130 [242003] automated match to d1kyaa1 complexed with cu, nag |
PDB Entry: 2h5u (more details), 1.9 Å
SCOPe Domain Sequences for d2h5ua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2h5ua1 b.6.1.0 (A:1-130) automated matches {Trametes maxima [TaxId: 259368]}
gvgpvadntitnaatspdgfsrqavvvngvtpgplvagnigdrfqlnvidnltnhtmlkt
tsvhwhgffqqgtnwadgpafinqcpispghsflydfqvpnqagtfwyhshlstqycdgl
rgpfvvydpn
Timeline for d2h5ua1: