Lineage for d2h4ma_ (2h4m A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2006337Superfamily a.118.1: ARM repeat [48371] (26 families) (S)
  5. 2006338Family a.118.1.1: Armadillo repeat [48372] (7 protein domains)
  6. 2006450Protein automated matches [190070] (4 species)
    not a true protein
  7. 2006457Species Human (Homo sapiens) [TaxId:9606] [187211] (12 PDB entries)
  8. 2006469Domain d2h4ma_: 2h4m A: [242001]
    automated match to d1qbkb_

Details for d2h4ma_

PDB Entry: 2h4m (more details), 3.05 Å

PDB Description: karyopherin beta2/transportin-m9nls
PDB Compounds: (A:) Transportin-1

SCOPe Domain Sequences for d2h4ma_:

Sequence, based on SEQRES records: (download)

>d2h4ma_ a.118.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kpdeqglqqilqllkesqspdttiqrtvqqkleqlnqypdfnnylifvltklksedeptr
slsglilknnvkahfqnfpngvtdfikseclnnigdsspliratvgilittiaskgelqn
wpdllpklcslldsedyntcegafgalqkicedsaeildsdvldrplnimipkflqffkh
sspkirshavacvnqfiisrtqalmlhidsfienlfalagdeepevrknvcralvmllev
rmdrllphmhniveymlqrtqdqdenvaleacefwltlaeqpickdvlvrhlpklipvlv
ngmkysdidiillkgdveedetipdseqdiggsggsgdtisdwnlrkcsaaaldvlanvy
rdellphilpllkellfhhewvvkesgilvlgaiaegcmqgmipylpeliphliqclsdk
kalvrsitcwtlsryahwvvsqppdtylkplmtellkrildsnkrvqeaacsafatleee
actelvpylayildtlvfafskyqhknllilydaigtladsvghhlnkpeyiqmlmppli
qkwnmlkdedkdlfplleclssvatalqsgflpycepvyqrcvnlvqktlaqamlnnaqp
dqyeapdkdfmivaldllsglaeglggnieqlvarsniltlmyqcmqdkmpevrqssfal
lgdltkacfqhvkpciadfmpilgtnlnpefisvcnnatwaigeisiqmgiemqpyipmv
lhqlveiinrpntpktllentaitigrlgyvcpqevapmlqqfirpwctslrnirdneek
dsafrgictmisvnpsgviqdfiffcdavaswinpkddlrdmfckilhgfknqvgdenwr
rfsdqfplplkerlaafygv

Sequence, based on observed residues (ATOM records): (download)

>d2h4ma_ a.118.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kpdeqglqqilqllkesqspdttiqrtvqqkpdfnnylifvltklksedeptrslsglil
knnvkfqnfpngvtdfikseclnnigdsspliratvgilittiaskgelqnwpdllpklc
slldsedyntcegafgalqkicedsaeildsdvldrplnimipkflqffkhsspkirsha
vacvnqfiisrtqalmlhidsfienlfalagdeepevrknvcralvmllevrmdrllphm
hniveymlqrtqdqdenvaleacefwltlaeqpickdvlvrhlpklipvlvngmkysdid
iillktisdwnlrkcsaaaldvlanvyrdellphilpllkellfhhewvvkesgilvlga
iaegcmqgmipylpeliphliqclsdkkalvrsitcwtlsryahwvvsqppdtylkplmt
ellkrildsnkrvqeaacsafatleeeactelvpylayildtlvfafskyqhknllilyd
aigtladsvghhlnkpeyiqmlmppliqkwnmlkdedkdlfplleclssvatalqsgflp
ycepvyqrcvnlvqktlaqamlnnaqpdqyeapdkdfmivaldllsglaeglggnieqlv
arsniltlmyqcmqdkmpevrqssfallgdltkacfqhvkpciadfmpilgtnlnpefis
vcnnatwaigeisiqmgiemqpyipmvlhqlveiinrpntpktllentaitigrlgyvcp
qevapmlqqfirpwctslrnirdneekdsafrgictmisvnpsgviqdfiffcdavaswi
npkddlrdmfckilhgfknqvgdenwrrfsdqfplplkerlaafygv

SCOPe Domain Coordinates for d2h4ma_:

Click to download the PDB-style file with coordinates for d2h4ma_.
(The format of our PDB-style files is described here.)

Timeline for d2h4ma_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2h4mb_