SCOPe 2.07: Domain d3gala_: 3gal A:

Lineage for d3gala_ (3gal A:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.3: Galectin (animal S-lectin) [49932] (9 proteins)

6. Protein Galectin-7 [100926] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49935] (6 PDB entries)

8. Domain d3gala_: 3gal A: [24200]
   complexed with 1gn

Details for d3gala_

PDB Entry: 3gal, 1.9 Å

PDB Description: crystal structure of human galectin-7 in complex with galactosamine

PDB Compounds: (A:) galectin-7

SCOPe Domain Sequences for d3gala_:

Sequence; same for both SEQRES and ATOM records:

>d3gala_ b.29.1.3 (A:) Galectin-7 {Human (Homo sapiens) [TaxId: 9606]}
nvphksslpegirpgtvlrirglvppnasrfhvnllcgeeqgsdaalhfnprldtsevvf
nskeqgswgreergpgvpfqrgqpfevliiasddgfkavvgdaqyhhfrhrlplarvrlv
evggdvqldsvrif

Timeline for d3gala_:

• d3gala_ first appeared (with stable ids) in SCOP 1.55
  
• d3gala_ appears in SCOPe 2.06
  
• d3gala_ appears in the current release, SCOPe 2.08