Lineage for d2h2wa_ (2h2w A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2101600Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2104318Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) (S)
    conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures
  5. 2104720Family c.23.16.8: HTS-like [142077] (2 protein domains)
    Pfam PF04204
  6. 2104721Protein Homoserine O-succinyltransferase HTS (MetA) [142078] (2 species)
  7. 2104724Species Thermotoga maritima [TaxId:2336] [255198] (1 PDB entry)
  8. 2104725Domain d2h2wa_: 2h2w A: [241998]
    automated match to d2ghra1

Details for d2h2wa_

PDB Entry: 2h2w (more details), 2.52 Å

PDB Description: crystal structure of homoserine o-succinyltransferase (ec 2.3.1.46) (homoserine o-transsuccinylase) (hts) (tm0881) from thermotoga maritima at 2.52 a resolution
PDB Compounds: (A:) Homoserine O-succinyltransferase

SCOPe Domain Sequences for d2h2wa_:

Sequence, based on SEQRES records: (download)

>d2h2wa_ c.23.16.8 (A:) Homoserine O-succinyltransferase HTS (MetA) {Thermotoga maritima [TaxId: 2336]}
pinvpsglpavkvlakegifvmtekraihqdirpleililnlmpdkikteiqllrllgnt
plqvnvtllytethkpkhtpiehilkfyttfsavkdrkfdgfiitgapvellpfeevdyw
eelteimewsrhnvystmficwaaqaglyyfygipkyelpqklsgvykhrvakdsvlfrg
hddffwaphsrytevkkedidkvpeleilaesdeagvyvvankserqifvtghpeydryt
lrdeyyrdigrnlkvpipanyfpnddptktpiltwwshahlffsnwlnyciyqkt

Sequence, based on observed residues (ATOM records): (download)

>d2h2wa_ c.23.16.8 (A:) Homoserine O-succinyltransferase HTS (MetA) {Thermotoga maritima [TaxId: 2336]}
pinvpsglpavkvlakegifvmtekirpleililnlmpdkikteiqllrllgntplqvnv
tllytethkpkhtpiehilkfyttfsavkdrkfdgfiitgapvellpfeevdyweeltei
mewsrhnvystmficwaaqaglyyfygipkyelpqklsgvykhrvakdsvlfrghddffw
aphsrytevkkedidkvpeleilaesdeagvyvvankserqifvtghpeydrytlrdeyy
rdigrnlkvpipanyfpnddptktpiltwwshahlffsnwlnyciyqkt

SCOPe Domain Coordinates for d2h2wa_:

Click to download the PDB-style file with coordinates for d2h2wa_.
(The format of our PDB-style files is described here.)

Timeline for d2h2wa_: