SCOPe 2.05: Domain d2h1gb_: 2h1g B:

Lineage for d2h1gb_ (2h1g B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins)

6. Protein Thiol-disulfide oxidoreductase ResA [102455] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [102456] (8 PDB entries)

8. Domain d2h1gb_: 2h1g B: [241994]
   automated match to d3c71a_

Details for d2h1gb_

PDB Entry: 2h1g, 3.1 Å

PDB Description: resa c74a/c77a

PDB Compounds: (B:) Thiol-disulfide oxidoreductase resA

SCOPe Domain Sequences for d2h1gb_:

Sequence; same for both SEQRES and ATOM records:

>d2h1gb_ c.47.1.10 (B:) Thiol-disulfide oxidoreductase ResA {Bacillus subtilis [TaxId: 1423]}
sdapnfvledtngkrielsdlkgkgvflnfwgtwaepakkefpymanqykhfksqgveiv
avnvgeskiavhnfmksygvnfpvvldtdrqvldaydvsplpttflinpegkvvkvvtgt
mtesmihdymnlikpge

Timeline for d2h1gb_:

• d2h1gb_ first appeared in SCOPe 2.04
  
• d2h1gb_ appears in SCOPe 2.06
  
• d2h1gb_ appears in the current release, SCOPe 2.08