![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
![]() | Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
![]() | Family c.47.1.10: Glutathione peroxidase-like [52901] (29 protein domains) |
![]() | Protein Thiol-disulfide oxidoreductase ResA [102455] (1 species) |
![]() | Species Bacillus subtilis [TaxId:1423] [102456] (8 PDB entries) |
![]() | Domain d2h1ga_: 2h1g A: [241993] automated match to d3c71a_ |
PDB Entry: 2h1g (more details), 3.1 Å
SCOPe Domain Sequences for d2h1ga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2h1ga_ c.47.1.10 (A:) Thiol-disulfide oxidoreductase ResA {Bacillus subtilis [TaxId: 1423]} sdapnfvledtngkrielsdlkgkgvflnfwgtwaepakkefpymanqykhfksqgveiv avnvgeskiavhnfmksygvnfpvvldtdrqvldaydvsplpttflinpegkvvkvvtgt mtesmihdymnlikpg
Timeline for d2h1ga_: