Lineage for d2h0pa_ (2h0p A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2765063Superfamily b.1.18: E set domains [81296] (27 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2766140Family b.1.18.0: automated matches [191341] (1 protein)
    not a true family
  6. 2766141Protein automated matches [190226] (81 species)
    not a true protein
  7. 2766224Species Dengue virus 4 [TaxId:11070] [195988] (5 PDB entries)
  8. 2766228Domain d2h0pa_: 2h0p A: [241992]
    automated match to d1s6na_

Details for d2h0pa_

PDB Entry: 2h0p (more details)

PDB Description: nmr structure of the dengue-4 virus envelope protein domain iii
PDB Compounds: (A:) Envelope glycoprotein

SCOPe Domain Sequences for d2h0pa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h0pa_ b.1.18.0 (A:) automated matches {Dengue virus 4 [TaxId: 11070]}
meklrikgmsytmcsgkfsidkemaetqhgttvvkvkyegagapckvpieirdvnkekvv
griisstplaentnsvtnieleppfgdsyivigvgnsaltlhwfrkgssigk

SCOPe Domain Coordinates for d2h0pa_:

Click to download the PDB-style file with coordinates for d2h0pa_.
(The format of our PDB-style files is described here.)

Timeline for d2h0pa_: