Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.1: Thioltransferase [52834] (16 proteins) |
Protein automated matches [190442] (13 species) not a true protein |
Species Bacillus subtilis [TaxId:1423] [255197] (3 PDB entries) |
Domain d2gzya_: 2gzy A: [241990] automated match to d3diea_ |
PDB Entry: 2gzy (more details)
SCOPe Domain Sequences for d2gzya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gzya_ c.47.1.1 (A:) automated matches {Bacillus subtilis [TaxId: 1423]} maivkatdqsfsaetsegvvladfwapwcgpckmiapvleeldqemgdklkivkidvden qetagkygvmsiptllvlkdgevvetsvgfkpkealqelvnkhl
Timeline for d2gzya_: