SCOP 1.69: Domain d2galb_: 2gal B:

Lineage for d2galb_ (2gal B:)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (21 families)

5. Family b.29.1.3: Galectin (animal S-lectin) [49932] (8 proteins)

6. Protein Galectin-7 [100926] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49935] (5 PDB entries)

8. Domain d2galb_: 2gal B: [24199]

Details for d2galb_

PDB Entry: 2gal, 2 Å

PDB Description: crystal structure of human galectin-7 in complex with galactose

SCOP Domain Sequences for d2galb_:

Sequence; same for both SEQRES and ATOM records:

>d2galb_ b.29.1.3 (B:) Galectin-7 {Human (Homo sapiens)}
phksslpegirpgtvlrirglvppnasrfhvnllcgeeqgsdaalhfnprldtsevvfns
keqgswgreergpgvpfqrgqpfevliiasddgfkavvgdaqyhhfrhrlplarvrlvev
ggdvqldsvrif

Timeline for d2galb_:

• d2galb_ first appeared (with stable ids) in SCOP 1.55
  
• d2galb_ appears in SCOP 1.67
  
• d2galb_ appears in SCOP 1.71
  
• d2galb_ appears in the current release, SCOPe 2.08